PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_20822_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 254aa    MW: 28699.8 Da    PI: 8.2162
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_20822_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.4e-14148248
                                         SSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                         g+W++eEd +l+  ++++G+g +W + +++ g++R++k+c++rw++yl
  cra_locus_20822_iso_4_len_761_ver_3  1 GPWSPEEDAKLKGFIEKFGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 48
                                         79********************************************97 PP

2Myb_DNA-binding38.62.5e-125597246
                                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                         g ++ eEd ++  + +  G++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_20822_iso_4_len_761_ver_3 55 GEFSDEEDRIICTLYASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 97
                                         789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-25195IPR009057Homeodomain-like
PROSITE profilePS5129412.779148IPR017930Myb domain
SMARTSM007171.8E-6150IPR001005SANT/Myb domain
PfamPF002493.4E-13148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-23155IPR009057Homeodomain-like
CDDcd001673.94E-8248No hitNo description
PROSITE profilePS5129422.41849103IPR017930Myb domain
SMARTSM007173.5E-1253101IPR001005SANT/Myb domain
PfamPF002495.0E-115597IPR001005SANT/Myb domain
CDDcd001678.06E-95699No hitNo description
Gene3DG3DSA:1.10.10.608.8E-2456103IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
GPWSPEEDAK LKGFIEKFGT GGNWIALPQK AGLKRCGKSC RLRWLNYLRP NIKHGEFSDE  60
EDRIICTLYA SIGSRWSIIA AQLPGRTDND IKNYWNTKLK KKLMGFINPL DQRIKLPHHH  120
QYPFSNSSSS NAIQYFTTSS AKSLSTTGLE PFSLDQPNML LFNNLDNFNP MQLYYPSGKD  180
NMLMFGGTEA SCSNSSDGSC SQISYGRDQI KQEPPAINGL QGYNIYDHHH HHHQENQKFV  240
LDYGNDNGGG GTWX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2511038108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011011978.13e-94PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL28e-66MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A068UFS86e-96A0A068UFS8_COFCA; Uncharacterized protein
STRINGPOPTR_0009s01270.16e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154